Protein coding transcript 251636

• Transcript: Ll_transcript_7474
• CDS coordinates: 2-319 (+)
• Peptide sequence: SSPSRKRWILGVVCIDPCNAVANAREENRFMNGIKYAVFTDKSIRLLVKNQYTSNVESGSTRTEIKHWVELFFGVKVIAMNSHRLLSTSTDPAPNDFDLPDHTSK*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_7474

• Blastp: 50S ribosomal protein L23, chloroplastic from Nicotiana with 85.94% of identity
• Blastx: 50S ribosomal protein L23, chloroplastic from Nicotiana with 85.94% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (800421)
• CantataDB: Link to cantataDB annotations (CNT0000963)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003605908.1)
• Pfam: Ribosomal protein L23 (PF00276.19)
• Rfam: SSU_rRNA_archaea (RF01959)
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;