Protein coding transcript 251639

• Transcript: Ll_transcript_7456
• CDS coordinates: 1797-2225 (+)
• Peptide sequence: MPLGTAIHNIEITLGKGGQLARAAGAVAKLIAKEGKSATLKLPSGEVRLISKNCSATVGQVGNVGVNQKSLGRAGSKCWLGKRPVVRGVVMNPVDHPHGGGEGRAPIGRKKPATPWGYPALGRRSRKRNKYSDNLILRRRSK*
• ORF Type: complete

Annotations of Ll_transcript_7456

• Blastp: 50S ribosomal protein L2, chloroplastic from Carica with 100% of identity
• Blastx: 30S ribosomal protein S3, chloroplastic from Lotus with 89.81% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0002678)
• Mirbase: osa-MIR5538 (MI0019059)
• Ncbi protein: Link to NCBI protein (YP_008963639.1)
• Pfam: Ribosomal Proteins L2, C-terminal domain (PF03947.17)
• Rfam: Intron_gpII (RF00029)
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;