Protein coding transcript 251674

• Transcript: Ll_transcript_7387
• CDS coordinates: 2832-3500 (+)
• Peptide sequence: MDPSAKNTESISRDHVVFEDHPGLVTITGGKWTTYRSMAEDAVNAAIKSGMLTPSNECVTNNLRIVGGEGWDPAFFTVLTQQYMRMKLSSKGKIVPGIMDSAAAKHLSRAYGTLAERVAAIAQDENLGKRLAHGYPFLEAEVAYCARHEYCESAIDFIARRSRLAFLDTDAAGRALPRVIQILAAEHKWDKSRQKEELQNAKAFLETFKSSKNAQFHDGKHV*
• ORF Type: complete

Annotations of Ll_transcript_7387

• Blastp: Glycerol-3-phosphate dehydrogenase SDP6, mitochondrial from Arabidopsis with 78.28% of identity
• Blastx: Glycerol-3-phosphate dehydrogenase SDP6, mitochondrial from Arabidopsis with 79.58% of identity
• Eggnog: glycerol-3-phosphate dehydrogenase(COG0578)
• Kegg: Link to kegg annotations (AT3G10370)
• CantataDB: Link to cantataDB annotations (CNT0001092)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462224.1)
• Pfam: C-terminal domain of alpha-glycerophosphate oxidase (PF16901.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;