Protein coding transcript 251688

• Transcript: Ll_transcript_7377
• CDS coordinates: 2-922 (+)
• Peptide sequence: PDYYSPDGMGLIVPKTKDGRVVFMLPWLGRTVAGTTDSSTNITYLPEPNEDEIKFILDAISGYLNVKVRRSDVLSAWSGIRPLASDPTAKNTESISRDHVVCEDQPGLVTITGGKWTTYRSMAEDAVNAAIKSGKLTPTNGCVTDNLRIAGGEGWEPSSFTVIAQQYRRMKSTHGGKVVPGAMDSAAAMHLSHAYGKLAEHVAAIAQDENLGKRLAHGYPYLEAEVAYCARNEYCESAIDFIARRTRLAFLETNAAKRALPRVIEILANEHKWDKSRQKEELQKATEFLKTFKSSNNAHFDDGKHN*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_7377

• Blastp: Glycerol-3-phosphate dehydrogenase SDP6, mitochondrial from Arabidopsis with 81.37% of identity
• Blastx: Glycerol-3-phosphate dehydrogenase SDP6, mitochondrial from Arabidopsis with 81.37% of identity
• Eggnog: glycerol-3-phosphate dehydrogenase(COG0578)
• Kegg: Link to kegg annotations (AT3G10370)
• CantataDB: Link to cantataDB annotations (CNT0001092)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428814.1)
• Pfam: FAD dependent oxidoreductase (PF01266.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;