Transcript | Ll_transcript_5951 |
---|---|
CDS coordinates | 94-789 (+) |
Peptide sequence | MLECVRKLISGQNVHVPIYDFKKHQRSSESFRQVNASDVIILEGILVLHDQQVRDLMNMKIFVDADADVRLARRIRRDTVERGRDINSVLEQYAKFVKPAFDDFILPSKKYADVIIPRGGDNHVAVDLIVQHIRTKLGQHDLCKIYPNVHVIQSTFQIRGMHTLIRDRDISKHDFVFYSDRLIRLVVEHGLGHLPFTEKQVVTPTGSVYTGVDFCKKLCGVSIVRSGESMEN |
ORF Type | 3prime_partial |
Blastp | Uridine kinase-like protein 1, chloroplastic from Arabidopsis with 88.36% of identity |
---|---|
Blastx | Uridine kinase-like protein 1, chloroplastic from Arabidopsis with 87.74% of identity |
Eggnog | Catalyzes the conversion of uracil and 5-phospho-alpha- D-ribose 1-diphosphate (PRPP) to UMP and diphosphate (By similarity)(COG0035) |
Kegg | Link to kegg annotations (AT5G40870) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_003547653.1) |
Pfam | Phosphoribulokinase / Uridine kinase family (PF00485.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer