Protein coding transcript 251741

• Transcript: Ll_transcript_7348
• CDS coordinates: 948-1325 (+)
• Peptide sequence: MFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRTEILKIHAAGIAKHGEIDYEAVVKLAEGFNGADL
• ORF Type: 3prime_partial

Annotations of Ll_transcript_7348

• Blastp: 26S proteasome regulatory subunit S10B homolog B from Arabidopsis with 95.24% of identity
• Blastx: 26S proteasome regulatory subunit S10B homolog B from Arabidopsis with 85.01% of identity
• Eggnog: 26S protease regulatory subunit(COG1222)
• Kegg: Link to kegg annotations (AT1G45000)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458747.1)
• Pfam: ATPase family associated with various cellular activities (AAA) (PF00004.28)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;