Transcript | Ll_transcript_7352 |
---|---|
CDS coordinates | 593-1003 (+) |
Peptide sequence | MTAIFLCMLDYYCLSCQVDPVVYNMLHEDPGNVSYSAVGGLSDQIRELRESIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVVSSAIIDKYIGESARLIREMFGYARDHQLCIIFMDE |
ORF Type | 3prime_partial |
Blastp | 26S proteasome regulatory subunit 10B homolog A from Arabidopsis with 92.8% of identity |
---|---|
Blastx | 26S proteasome regulatory subunit 10B homolog A from Arabidopsis with 82.19% of identity |
Eggnog | 26S protease regulatory subunit(COG1222) |
Kegg | Link to kegg annotations (AT5G43010) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019417725.1) |
Pfam | Holliday junction DNA helicase ruvB N-terminus (PF05496.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer