Protein coding transcript 251756

• Transcript: Ll_transcript_7337
• CDS coordinates: 366-677 (+)
• Peptide sequence: MVILCLCFISVIVKASSGPRYVVGCRSKVDKEKLTSGTRVVLDMTTLTIMRALPREVDPVVYNMLHEDPGNVSYSAVGGLSDQIRELRESIELPLMNPELFLRV
• ORF Type: 3prime_partial

Annotations of Ll_transcript_7337

• Blastp: 26S proteasome regulatory subunit S10B homolog B from Arabidopsis with 96.81% of identity
• Blastx: 26S proteasome regulatory subunit S10B homolog B from Arabidopsis with 96.81% of identity
• Eggnog: 26S protease regulatory subunit(COG1222)
• Kegg: Link to kegg annotations (AT1G45000)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020980157.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;