Protein coding transcript 251822

• Transcript: Ll_transcript_5923
• CDS coordinates: 194-766 (+)
• Peptide sequence: MGYGRSPSVIVLLPTRELAKQVHADFEAYGGAVGLASCCLYGGAPYQTQEMKLKRGVDIVIGTPGRIKDHIERGNIDLSLLRFRVLDEADEMLRMGFVEDVELILGKVDDVNKVQTLLFSATLPDWVKQISTRFLKRDKKTADLVGNGKMKASNNVRHIVLPCNSSARSQLIPDIIRCYSSGGRTIIFTEK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_5923

• Blastp: DEAD-box ATP-dependent RNA helicase 7 from Arabidopsis with 80.53% of identity
• Blastx: DEAD-box ATP-dependent RNA helicase 7 from Arabidopsis with 81.4% of identity
• Eggnog: purine NTP-dependent helicase activity(COG0513)
• Kegg: Link to kegg annotations (AT5G62190)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413634.1)
• Pfam: DEAD/DEAH box helicase (PF00270.28)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;