Protein coding transcript 251881

• Transcript: Ll_transcript_5442
• CDS coordinates: 25-465 (+)
• Peptide sequence: MVVSYLNRCNQFGVISSDFTNRILLTSTSEVYGDPLVHPQPESYWGNVNPIGVRSCYDEGKRVAETLMFDYHRQHGLEIRIARIFNTYGPRMNIDDGRVVSNFIAQALRALPVTMSCSMIMLFTFHLSPLSMLILTRFSSTFGLLW*
• ORF Type: complete

Annotations of Ll_transcript_5442

• Blastp: UDP-glucuronic acid decarboxylase 3 from Arabidopsis with 91.58% of identity
• Blastx: UDP-glucuronic acid decarboxylase 5 from Arabidopsis with 81.9% of identity
• Eggnog: Nad-dependent epimerase dehydratase(COG0451)
• Kegg: Link to kegg annotations (AT5G59290)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014498188.1)
• Pfam: GDP-mannose 4,6 dehydratase (PF16363.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;