Transcript | Ll_transcript_5419 |
---|---|
CDS coordinates | 802-1146 (+) |
Peptide sequence | MRILVTGGAGFIGSHLVDRLMENEKNEVIVADNYFTGSKDNLKKWIGHPRFELIRHDVTEPLLIEVDQIYHLACPASPIFYKYNPVKTIKTNVIGTLNMLGLAKRVGARLPNCL* |
ORF Type | complete |
Blastp | UDP-glucuronic acid decarboxylase 5 from Arabidopsis with 96.36% of identity |
---|---|
Blastx | UDP-glucuronic acid decarboxylase 5 from Arabidopsis with 81.93% of identity |
Eggnog | Nad-dependent epimerase dehydratase(COG0451) |
Kegg | Link to kegg annotations (AT3G46440) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_017425701.1) |
Pfam | NAD dependent epimerase/dehydratase family (PF01370.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer