Protein coding transcript 251886

• Transcript: Ll_transcript_5420
• CDS coordinates: 142-462 (+)
• Peptide sequence: MCIGLNYMMITGVRSCYDEGKRVAETLMFDYHRQHGLEIRIARIFNTYGPRMNIDDGRVVSNFIAQALRALPVTMSCSMIMLFTFHLSPLSMLILTRFSSTFGLLW*
• ORF Type: complete

Annotations of Ll_transcript_5420

• Blastp: UDP-glucuronic acid decarboxylase 5 from Arabidopsis with 90.62% of identity
• Blastx: UDP-glucuronic acid decarboxylase 5 from Arabidopsis with 81.9% of identity
• Eggnog: Nad-dependent epimerase dehydratase(COG0451)
• Kegg: Link to kegg annotations (AT3G46440)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447935.1)
• Pfam: NAD dependent epimerase/dehydratase family (PF01370.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;