Transcript | Ll_transcript_328967 |
---|---|
CDS coordinates | 3-371 (+) |
Peptide sequence | YIHIHQSSSINPYPLTSAIMSMLKNIKSLAPLLDRVLVQRMKAETKTSSGIFLPDSAVKELNEGKVLAVGPGLHDKDGKRIPLGVQAGDKVLIPQFGGSPIKVGEEEFTLFRDHELLAKINE* |
ORF Type | 5prime_partial |
Blastp | - |
---|---|
Blastx | 10 kDa heat shock protein, mitochondrial from Schizosaccharomyces with 58.65% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (SPCC550.06c) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_020227687.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer