Protein coding transcript 251940

• Transcript: Ll_transcript_7493
• CDS coordinates: 167-643 (+)
• Peptide sequence: MASVSTQPQFRYTQPPSKVLHLRNLPWECTEEELIELGKPFGKVVNTKCNVGANRNQAFIEFQDLNQAIAMISYYASSSEPAQVRGKTVYLQYSNRQEIVNNKTAADVAGNVLLVTIEGEDARLVSIDVLHLVFSAFGFVHKITTFEKTAGFQGPFHQ*
• ORF Type: complete

Annotations of Ll_transcript_7493

• Blastp: Polypyrimidine tract-binding protein homolog 2 from Arabidopsis with 92.86% of identity
• Blastx: Polypyrimidine tract-binding protein homolog 2 from Arabidopsis with 92.86% of identity
• Eggnog: polypyrimidine tract binding protein(ENOG410XPMZ)
• Kegg: Link to kegg annotations (AT5G53180)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437395.1)
• Pfam: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF00076.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;