| Transcript | Ll_transcript_366998 |
|---|---|
| CDS coordinates | 3-299 (+) |
| Peptide sequence | SLITNMSSLKLQKRLAASVMRCGKKKVWLDPNEINEIANTNSRQNIRKLIKDGLIIKKPVAVHSRSRVRKNTEARRKGRHCGFGKRKGTANARMPQKLL |
| ORF Type | internal |
| Blastp | - |
|---|---|
| Blastx | 60S ribosomal protein L19 from Sophophora with 95.74% of identity |
| Eggnog | ribosomal protein L19(COG2147) |
| Kegg | Link to kegg annotations (Dmel_CG2746) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (NP_001241295.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer