Protein coding transcript 252028

• Transcript: Ll_transcript_5045
• CDS coordinates: 270-1157 (+)
• Peptide sequence: MVARGVPAKTAAALAAVLFSETQSSNWWRDINDSPFWQDRIFLLLAALYGIVSAVALVQLFRIQLRVPEYGWTTQKVFHFLNFLVNGVRCSVFIFRRDVQKLQPEIVQHILLDMPSLAFFTTYALLVLFWAEIYYQARAVSTDGLRPSFYTINAVVYIVQIVLWLILWWKPVSVLVIVSKMFFAGVSLFAALAFLLYGGRLFLMLQRFPVESKGRRKKLQEVGYVTTICFSCFFVRCVMMCFNAFDKAADLDVLNHSVLNFIYYLLVEILPSSLVLFILRKLPPKRGITQYHQIH*
• ORF Type: complete

Annotations of Ll_transcript_5045

• Blastp: Tobamovirus multiplication protein 3 from Arabidopsis with 82.56% of identity
• Blastx: Tobamovirus multiplication protein 3 from Arabidopsis with 84.62% of identity
• Eggnog: tobamovirus multiplication(ENOG41110A4)
• Kegg: Link to kegg annotations (AT2G02180)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459951.1)
• Pfam: Protein of unknown function (DUF1084) (PF06454.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;