Transcript | Ll_transcript_5047 |
---|---|
CDS coordinates | 206-949 (+) |
Peptide sequence | MVTRDVFLFSETQSSNWWHDIDVSPLWQDLIFHVLAALYGIVSAIALVQLVRIQLRVPEYGWTTQKVFHFLNFLVNGVRCSVFIFRRDVQQLQPEIVQHILLDLPSLAFFTTYALLVLFWAEIYYQARAVSTDGLRPCFYTINAVAYIVQIALWLILWWKPVSVLVIMSKMFFAGVSLFAALGFLLYGGRLFLMLQRFPVESKGRRKKLQEVGYVTTICFSCFLVRCVMVSLFSFINFSDPIAWLTY* |
ORF Type | complete |
Blastp | Tobamovirus multiplication protein 3 from Arabidopsis with 80.87% of identity |
---|---|
Blastx | Tobamovirus multiplication protein 3 from Arabidopsis with 81.14% of identity |
Eggnog | tobamovirus multiplication(ENOG41110A4) |
Kegg | Link to kegg annotations (AT2G02180) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019464318.1) |
Pfam | Protein of unknown function (DUF1084) (PF06454.10) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer