Protein coding transcript 252032

• Transcript: Ll_transcript_5052
• CDS coordinates: 24-725 (+)
• Peptide sequence: MDNKSNVIIERQIKRYFLCVTICDYYLFSFLELKKKKVFIFLSMEFSNWWHHINDSPFWQDRIFHLLAALYAVVAVIALVQLVRIQLRVPEYGWTTQKLFHFLNFFVNAVRCSVFIFRRDVHKLQPDIVQHILLDMPSLAFFTTYTLLVLFWAEIYYQARAVSTDGLRPSFYTINAVVYIVQIVLWLILWWKPVSVLVIVSKMFFAGVSLFAALAFLLYGGRYHTKQGSKQHIS
• ORF Type: 3prime_partial

Annotations of Ll_transcript_5052

• Blastp: Tobamovirus multiplication protein 3 from Arabidopsis with 79.21% of identity
• Blastx: Tobamovirus multiplication protein 3 from Arabidopsis with 79.21% of identity
• Eggnog: tobamovirus multiplication(ENOG41110A4)
• Kegg: Link to kegg annotations (AT2G02180)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458728.1)
• Pfam: Protein of unknown function (DUF1084) (PF06454.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;