Transcript | Ll_transcript_7225 |
---|---|
CDS coordinates | 2-667 (+) |
Peptide sequence | LSEGTASDSEDDNERHDAAEEETDDDENGFFDTRDFLSSSSFKSNGSDYIVSSSSSDNEGIHAFESEGDAHPSVRTAVTKYPRVKRRKKLPDPVEKEKGVSLWSMIKDNIGKDLTKVCLPVYFNEPLSSLQKCCEEMEYSYLLDQAYEWGRQGNSLMRILYVAAFAVSGYASTEGRICKPFNPLLGETYEANFPDKGLRFFSEKVSHHPMIVACHCEGTGWK |
ORF Type | internal |
Blastp | Oxysterol-binding protein-related protein 1C from Arabidopsis with 79.73% of identity |
---|---|
Blastx | Oxysterol-binding protein-related protein 1C from Arabidopsis with 79.73% of identity |
Eggnog | Oxysterol-binding protein(ENOG410XP9E) |
Kegg | Link to kegg annotations (AT4G08180) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019433164.1) |
Pfam | Oxysterol-binding protein (PF01237.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer