Protein coding transcript 252072

• Transcript: Ll_transcript_7228
• CDS coordinates: 529-1080 (+)
• Peptide sequence: MHPFCCVSAVSDQSSPVKPSPTPFPDSTATMATLPSTATEIRSGSIPRHSHSHSHGSIISVECMRLSQREQQQPQPVAVMDVKINDLVGNGISGILYKWVNYGKGWRPRWFVLQDGVLSYYKIHGPDKIIVNSETEKGSKVIGEESMRRISRNRNSSSYQHRRKPFGEIHLKVPIEFQFSAVI*
• ORF Type: complete

Annotations of Ll_transcript_7228

• Blastp: Oxysterol-binding protein-related protein 1C from Arabidopsis with 59.16% of identity
• Blastx: Oxysterol-binding protein-related protein 1C from Arabidopsis with 53.93% of identity
• Eggnog: Oxysterol-binding protein(ENOG410XP9E)
• Kegg: Link to kegg annotations (AT4G08180)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433164.1)
• Pfam: PH domain (PF00169.28)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;