Protein coding transcript 252088

• Transcript: Ll_transcript_5363
• CDS coordinates: 221-631 (+)
• Peptide sequence: MAGIASEEFGVGKSVEEISSAQRCQSGEALAEWRSSEQVENGIASTSPPYWDTDEDDDGPKPVELYGKHTWKIEKFSQITKRELRSNAFEVGGYKWYILIYPQGCDVCNHLSLFLCVANHDKLLPGLIIQFFRLHW*
• ORF Type: complete

Annotations of Ll_transcript_5363

• Blastp: MATH domain-containing protein At5g43560 from Arabidopsis with 72.66% of identity
• Blastx: MATH domain-containing protein At5g43560 from Arabidopsis with 72.66% of identity
• Eggnog: math domain-containing protein(ENOG410ZKXJ)
• Kegg: Link to kegg annotations (AT5G43560)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449965.1)
• Pfam: MATH domain (PF00917.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;