Protein coding transcript 252102

• Transcript: Ll_transcript_6814
• CDS coordinates: 257-1543 (+)
• Peptide sequence: MASSDHNDTVFADEDIDDDDEESHDDLLQDEEEEEEDEKELDDDVLPDADENEPSTSVLAVTIAVAPPISPATTASDSKRHQIEEKKPIDDSRKLFQRLWTDEDEIELLQGFLDYTSNRGSSHHNDTALFYDQIKSRFQIDFNKNQLVEKIRRLKKKYRNVVSKINSAKEFSFKSAHDQATFEISRKIWSNIGQVSGGFVVDDKVLDEDEINLNSNQNPNNHYPNHNPNINLNLVQSTPKYEVVMLGNSGEKKFTPSRKRSRPRSAMMSIDEKPQILFNDGLGSGLGLNFNLNKDHSCIMNSNTAAANVNNDKNHENNCNNEQQHSNSIPGLVEETVRSCLTPVLKELMGGGVMGGGLFGARGFGLLNSMQMSMVTPLSFSGFGSSGDVVDEKWRKQQILELEVYAKRLELVQDQIKAALGELRSAGG*
• ORF Type: complete

Annotations of Ll_transcript_6814

• Blastp: Probable transcription factor At5g28040 from Arabidopsis with 40.71% of identity
• Blastx: Probable transcription factor At5g28040 from Arabidopsis with 41.28% of identity
• Eggnog: Transcription regulator(ENOG410YGHJ)
• Kegg: Link to kegg annotations (AT5G28040)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419992.1)
• Pfam: Protein of unknown function, DUF573 (PF04504.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;