Protein coding transcript 252126

• Transcript: Ll_transcript_5310
• CDS coordinates: 222-761 (+)
• Peptide sequence: MLGSKPLLGKIKFPMPLMWVNQNSVPINVDVPSIQDETHCSSPNDAEVVRPQQISSIWNHFERHRIDGKWKATCKYCGKQLVGDSSQGTKHLHNHFKSCLRRSTSDIKQGLLKTTKKGTESVLIGTYAFNQEAARHALAKMIIFHEYPMSMVDHVLFKEFCGALQPLFKGISHNTVKGDI
• ORF Type: 3prime_partial

Annotations of Ll_transcript_5310

• Blastp: Zinc finger BED domain-containing protein DAYSLEEPER from Arabidopsis with 30.81% of identity
• Blastx: Zinc finger BED domain-containing protein DAYSLEEPER from Arabidopsis with 29.07% of identity
• Eggnog: zinc finger(ENOG41115TD)
• Kegg: Link to kegg annotations (AT3G42170)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427131.1)
• Pfam: BED zinc finger (PF02892.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;