Protein coding transcript 252187

• Transcript: Ll_transcript_7770
• CDS coordinates: 113-907 (+)
• Peptide sequence: MALNLSSPADVKSLFFTDSFKSNTLINAKFPGSFSMKRKDGGATVGRRVFCSAQAPPPAWPGRAVPEASRKTWEGPKPISIVGSTGSIGTQTLDIVAENPEKFKVVALAAGSNITLLADQIKRFKPQLVSVKDESLIAELEEALNGIEHKPEIIPGEQGIIEVARHPDAVTVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAKKHNIKILPADSEHSAIFQCIQGLPEGALRKIILTASGGSFRYAYTPMLY*
• ORF Type: complete

Annotations of Ll_transcript_7770

• Blastp: 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic from Mentha with 80.63% of identity
• Blastx: 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic from Mentha with 80.63% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456932.1)
• Pfam: 1-deoxy-D-xylulose 5-phosphate reductoisomerase (PF02670.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;