Transcript | Ll_transcript_7764 |
---|---|
CDS coordinates | 231-944 (+) |
Peptide sequence | MVEQQLEDEFFCSAQAPPPAWPGRAVPEASRKTWEGPKPISIVGSTGSIGTQTLDIVAENPDKFKVVALAAGSNVTLLADQIKRFKPQLVSVRNESLAAELEEALNGVEQKPEIIPGEQGIIEVARHPDAVTVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAKKHNIKILPADSEHSAIFQCIQGLPEGALRKIILTASGGSFRDWPVEKLKDVKVADALKHPNW |
ORF Type | 3prime_partial |
Blastp | 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic from Mentha with 87.34% of identity |
---|---|
Blastx | 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic from Mentha with 87.34% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019456932.1) |
Pfam | 1-deoxy-D-xylulose 5-phosphate reductoisomerase (PF02670.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer