Protein coding transcript 252245

• Transcript: Ll_transcript_7090
• CDS coordinates: 1-468 (+)
• Peptide sequence: SPLGEACSRKDLTAIHAVLENLGYKDDEGVTNELSFHMWTDQMQDTLNCKKRGDVAFQQKDFRLALMCYTQFIDAGTMVSPTVYVRRSLCHLISDMPPEALNDAMQAQVISPVWHIASYLQSVALAGLGMENEAQAALKDGTTLESKWKGSSKQK*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_7090

• Blastp: Probable serine/threonine-protein kinase At5g41260 from Arabidopsis with 72.79% of identity
• Blastx: Probable serine/threonine-protein kinase At5g41260 from Arabidopsis with 72.79% of identity
• Eggnog: serine threonine-protein kinase(ENOG410XQTV)
• Kegg: Link to kegg annotations (AT5G41260)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456338.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;