Protein coding transcript 252259

• Transcript: Ll_transcript_7825
• CDS coordinates: 1-399 (+)
• Peptide sequence: MVVCWLCYLGNFCSDKKPAAVNWIEGRGKSVVCEAIIEEEVVKKVLKTNVAALVELNMLKNLAGSAVAGALGGYNAHASNIVSAIFIATGQDPAQNIESSHCITMMEAVNDGKDIHISVTMPSIEVQLIVDI*
• ORF Type: complete

Annotations of Ll_transcript_7825

• Blastp: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2 from Hevea with 93.16% of identity
• Blastx: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2 from Hevea with 90.83% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434252.1)
• Pfam: Hydroxymethylglutaryl-coenzyme A reductase (PF00368.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;