Transcript | Ll_transcript_6639 |
---|---|
CDS coordinates | 2374-3156 (+) |
Peptide sequence | MKAVGVVEATCEEVFELVMSMDGTRFEWDCSFQHGSLVEEVDGHTAVLYHRLQLDWFPMFVWPRDLCYVRYWRRNDDGSYVVLFRSREHENCSPQPGCVRANIESGGFNISPLKPRNGRPRTQVQHLMQIDLKGWGVGYMSSFQQHCLRQMLNCVAGLREWFAQTDERNAPPRIPVMVNMSSASLSSKKNLKPNDSSVHPPSLDQLNSASRNSAYQDEYSDEDEDFQIAEPEQEAYPIDHENDARRTVLEEEPADEIDLSS |
ORF Type | 3prime_partial |
Blastp | Protein ENHANCED DISEASE RESISTANCE 2 from Arabidopsis with 76.54% of identity |
---|---|
Blastx | Protein ENHANCED DISEASE RESISTANCE 2 from Arabidopsis with 71.27% of identity |
Eggnog | Domain containing protein, expressed(ENOG4112846) |
Kegg | Link to kegg annotations (AT4G19040) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019445237.1) |
Pfam | START domain (PF01852.18) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer