Protein coding transcript 252290

• Transcript: Ll_transcript_6643
• CDS coordinates: 3705-4676 (+)
• Peptide sequence: MQIDLKGWGVGYMPSFQQHCLRQMLNCVAGLREWFSQADERNAPPRIPVMVNMSSASVSSKKTLKPNDSSVHPTSLNQLNSASRNSAYQDEYSDEDEDFQIAEPEQEAYPIDHENDARRTVLEEEPADEIDLSSFKGNLRRDDRDNARDCWKISDGNNFRVRSKHFCYDKSKVPAGKHLLDLVAVDWFKDSKRMDHVAKCHGCAAQVASEKGFFSIIINLQVPGSTHYSMVFYFVTRELVPGSLLQRFVDGDDEFRNSRLKLIPSVPKGSWIVRQSVGSTPCILGKAVDCNYIRGPKYLEIDVDIGSSTVANGVLGLVVGVITT
• ORF Type: 3prime_partial

Annotations of Ll_transcript_6643

• Blastp: Protein ENHANCED DISEASE RESISTANCE 2 from Arabidopsis with 73.01% of identity
• Blastx: Protein ENHANCED DISEASE RESISTANCE 2 from Arabidopsis with 74.14% of identity
• Eggnog: Domain containing protein, expressed(ENOG4112846)
• Kegg: Link to kegg annotations (AT4G19040)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445237.1)
• Pfam: Protein of unknown function (DUF1336) (PF07059.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;