Transcript | Ll_transcript_6623 |
---|---|
CDS coordinates | 3596-4630 (+) |
Peptide sequence | MQIDLKGWGVGYMPSFQQHCLRQMLNCVAGLREWFSQADERNAPPRIPVMVNMSSASVSSKKTLKPNDSSVHPTSLNQLNSASRNSAYQDEYSDEDEDFQIAEPEQEAYPIGLENDIRRTVLEEEPVDEIDLSSFSGNLRRDDRDNARDCWKISDGNNFRVRSKHFCYDKSKVPAGKHLLDLVAVDWLKDSKRMDHVAKRNGCAAQVAIEKGFFSFIINLQVPGSTHYSMVFYFVTRELVPGSLLHRFVDGDDEFRNSRLKLIPSVPKGSWIVRQSVGSTPCLLGKAVDCNYIRDPKYLEIDVDIGSSTVANGVLGLVVGVITTLVVDMAFLIQVYFLWCDYIQ* |
ORF Type | complete |
Blastp | Protein ENHANCED DISEASE RESISTANCE 2 from Arabidopsis with 72.7% of identity |
---|---|
Blastx | Protein ENHANCED DISEASE RESISTANCE 2 from Arabidopsis with 73.82% of identity |
Eggnog | Domain containing protein, expressed(ENOG4112846) |
Kegg | Link to kegg annotations (AT4G19040) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019423707.1) |
Pfam | Protein of unknown function (DUF1336) (PF07059.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer