Protein coding transcript 252296

• Transcript: Ll_transcript_6651
• CDS coordinates: 2799-3428 (+)
• Peptide sequence: MLCVHHGRFVWPRDLCYVRYWRRNDDGSYVVLFRSREHENCSPQPGCVRANIESGGFNISPLKPRNGRPRTQVQHLMQIDLKGWGVGYMSSFQQHCLRQMLNCVAGLREWFAQTDERNAPPRIPVMVNMSSASLSSKKNLKPNDSSVHPPSLDQLNSASRNSAYQDEYSDEDEDFQIAEPEQEAYPIDHENDARRTVLEEEPADEIDLSS
• ORF Type: 3prime_partial

Annotations of Ll_transcript_6651

• Blastp: Protein ENHANCED DISEASE RESISTANCE 2 from Arabidopsis with 72.14% of identity
• Blastx: Protein ENHANCED DISEASE RESISTANCE 2 from Arabidopsis with 85.62% of identity
• Eggnog: Domain containing protein, expressed(ENOG4112846)
• Kegg: Link to kegg annotations (AT4G19040)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445236.1)
• Pfam: START domain (PF01852.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;