Protein coding transcript 252306

• Transcript: Ll_transcript_6043
• CDS coordinates: 231-683 (+)
• Peptide sequence: MFSVNEMKGISVKEESETVTVAVASGSSSSSSSNLSPQPMEGLHEMGPPPFLTKTFDVVEDPSTDSVVSWSINRNSFVVWDSHKFSTAILPRYFKHNNFSSFVRQLNTYVCFSLFIYYYVYFHTMIHKFGNCCIKIGKLSMSTSLFREWF*
• ORF Type: complete

Annotations of Ll_transcript_6043

• Blastp: Heat stress transcription factor A-2 from Arabidopsis with 72.83% of identity
• Blastx: Heat stress transcription factor A-2 from Arabidopsis with 80.82% of identity
• Eggnog: Transcription factor(COG5169)
• Kegg: Link to kegg annotations (AT2G26150)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417187.1)
• Pfam: HSF-type DNA-binding (PF00447.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;