Transcript | Ll_transcript_6044 |
---|---|
CDS coordinates | 231-560 (+) |
Peptide sequence | MFSVNEMKGISVKEESETVTVAVASGSSSSSSSNLSPQPMEGLHEMGPPPFLTKTFDVVEDPSTDSVVSWSINRNSFVVWDSHKFSTAILPRYFKHNNFSSFVRQLNTY* |
ORF Type | complete |
Blastp | Heat stress transcription factor A-2 from Arabidopsis with 72.83% of identity |
---|---|
Blastx | Heat stress transcription factor A-2 from Arabidopsis with 80.82% of identity |
Eggnog | Transcription factor(COG5169) |
Kegg | Link to kegg annotations (AT2G26150) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019417187.1) |
Pfam | HSF-type DNA-binding (PF00447.16) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer