Transcript | Ll_transcript_6945 |
---|---|
CDS coordinates | 2-1195 (+) |
Peptide sequence | LGLSPNSNTIPSSSILSPPTLSLISFTYISLPFSLSLPFHYKGGKRLICCVQKIDHKTVPIVPINPMASEHESPELNRNLYPNVEPYATGFLKVSDIHTIYWEQSGNPSGHPVVFIHGGPGGGTSPSNRRFFDPDFYQIILFDQRGAGKSTPHACLEENTTWDLIDDIEKLREHLEIPEWQVFGGSWGSTLALAYSQAHPDKVTGIILRGIFLLRKKEIDWFYEGGAAALFPDVWESFRDVIPENERGCFVDAYRKRLNSDDIETQYAAARAWTKWEMMTAHLLPNEDTSKKGDDDYFSLAFARIENHYFVNKGFFPTDSFLLDGVDKIRHINTVIVQGRYDVCCPMMSAWDLHKAWPEADFRVVPDAGHSANEPGVAAELVAANEKLKNLIKNKGN* |
ORF Type | 5prime_partial |
Blastp | Proline iminopeptidase from Arabidopsis with 81.01% of identity |
---|---|
Blastx | Proline iminopeptidase from Arabidopsis with 81.49% of identity |
Eggnog | proline iminopeptidase(ENOG410XPKQ) |
Kegg | Link to kegg annotations (AT2G14260) |
CantataDB | Link to cantataDB annotations (CNT0001295) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019440313.1) |
Pfam | alpha/beta hydrolase fold (PF00561.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer