Protein coding transcript 252325

• Transcript: Ll_transcript_6947
• CDS coordinates: 503-865 (+)
• Peptide sequence: MMTAHLLPNEDTSKKGDDDYFSLAFARIENHYFVNKGFFPTDSFLLDGVDKIRHINTVIVQGRYDVCCPMMSAWDLHKAWPEADFRVVPDAGHSANEPGVAAELVAANEKLKNLIKNKGN*
• ORF Type: complete

Annotations of Ll_transcript_6947

• Blastp: Proline iminopeptidase from Arabidopsis with 77.39% of identity
• Blastx: Proline iminopeptidase from Arabidopsis with 80.43% of identity
• Eggnog: proline iminopeptidase(ENOG410XPKQ)
• Kegg: Link to kegg annotations (AT2G14260)
• CantataDB: Link to cantataDB annotations (CNT0001295)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440313.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;