Protein coding transcript 252337

• Transcript: Ll_transcript_6567
• CDS coordinates: 2-1102 (+)
• Peptide sequence: HFFVIVIIFDLFLCCRYLIVTKCQPVSPALEAEIKSEVKTAGSAFSATGIVLKPKQETVAKSAAQIVHEQHQNATRTERKAVSRRVNPLVSLNPYQGNWTIKVSVTSKGNMHTYKNARGEGCLFNVELTDEDGTQIQAKMFNEAARKFYDKFVLGKVYYISKGTLKVANKQFKTVQNDYEMTLNDYSEVEEVADEAGFVPATKFSFVQIDQLGPYVNKNELVDIVGVVQNVSSTMSIRRKSNNETVPKRDITIADDTKKTVVLSLWNDLATNIGQELLDIADQSPVVVIKSLKVGDFNGVSLSTVSRSVVLINPDIPEVKKLRCWYDSEGKEAAMASIGAGSRPAATYGNRSVYSDRVLLSHITSNP
• ORF Type: internal

Annotations of Ll_transcript_6567

• Blastp: Replication protein A 70 kDa DNA-binding subunit B from Arabidopsis with 68.47% of identity
• Blastx: Replication protein A 70 kDa DNA-binding subunit B from Arabidopsis with 68.47% of identity
• Eggnog: DNA replication(COG1599)
• Kegg: Link to kegg annotations (AT5G08020)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438893.1)
• Pfam: OB-fold nucleic acid binding domain (PF01336.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;