| Transcript | Ll_transcript_7941 |
|---|---|
| CDS coordinates | 1177-1494 (+) |
| Peptide sequence | MSSLWRMLYMIKPEFFPNGPDVVILDTVLIDQPKVQIIYHNIETLESHFSTALDLTRLEIQVGSARSLHPGKSSPDRSRPDCFLKMVLYKTPYHCIVVPCKHYYR* |
| ORF Type | complete |
| Blastp | NADPH-dependent diflavin oxidoreductase 1 from Arabidopsis with 46.51% of identity |
|---|---|
| Blastx | NADPH-dependent diflavin oxidoreductase 1 from Arabidopsis with 76.6% of identity |
| Eggnog | Component of the sulfite reductase complex that catalyzes the 6-electron reduction of sulfite to sulfide. This is one of several activities required for the biosynthesis of L- cysteine from sulfate. The flavoprotein component catalyzes the electron flow from NADPH - FAD - FMN to the hemoprotein component (By similarity)(COG0369) |
| Kegg | Link to kegg annotations (AT3G02280) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019452078.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer