Protein coding transcript 252347

• Transcript: Ll_transcript_7952
• CDS coordinates: 1-333 (+)
• Peptide sequence: ICFILCILISCFLQTLLSFEEAVIFVVSTTAQGDTPDSIKVFWKFLLQRNLTSSWLKGVHYAVFGLGDSSYPKYNFVAKKLDKRLIDLGGTPIVERGLGDDQHPSGFNTS*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_7952

• Blastp: NADPH-dependent diflavin oxidoreductase 1 from Arabidopsis with 74.19% of identity
• Blastx: NADPH-dependent diflavin oxidoreductase 1 from Arabidopsis with 73.4% of identity
• Eggnog: Component of the sulfite reductase complex that catalyzes the 6-electron reduction of sulfite to sulfide. This is one of several activities required for the biosynthesis of L- cysteine from sulfate. The flavoprotein component catalyzes the electron flow from NADPH - FAD - FMN to the hemoprotein component (By similarity)(COG0369)
• Kegg: Link to kegg annotations (AT3G02280)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452078.1)
• Pfam: Flavodoxin (PF00258.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;