Transcript | Ll_transcript_177347 |
---|---|
CDS coordinates | 160-645 (+) |
Peptide sequence | MTMASLSLRFLSLTRRAFSSSSALKFNGGVSMVQGASRGIGLQFVKQLLENNDRGHVIATCRNPNSSTGLIHLKDKFADRLKILPLDLTDESSIEASALSIKDAYGHLNLLINASGILSIPQVLQPETTLNKLEKSSLMLAYEVNAVGPILVIKVTPPNFH* |
ORF Type | complete |
Blastp | Benzil reductase ((S)-benzoin forming) IRC24 from Saccharomyces with 36.56% of identity |
---|---|
Blastx | Benzil reductase ((S)-benzoin forming) IRC24 from Saccharomyces with 36.96% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (YIR036C) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019418201.1) |
Pfam | KR domain (PF08659.9) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer