Protein coding transcript 252494

• Transcript: Ll_transcript_177351
• CDS coordinates: 882-1661 (+)
• Peptide sequence: MATVIAAKDSSPIDDAETIKRACQGLGTDEKALISILAHRNEAQRKLVRLAFQEIYHQDLIQQLQSELSGSFQRAISHWTMDPSERDAVIAHEALKKATPDYKVLIEIACTRTSQEIVAIKGSYQFLYKHSLDEDVASKTNFDIRKLLVAIISAYRYDGDEFDESVAHSEANILHHAIENKVFNHDEIIRILSTRSKKQLCVTFNAFRNIYGTTITKGLLSNPIDDDDEYLGALRTTIRCIKYPQRYFAKVTKAMNLCY*
• ORF Type: complete

Annotations of Ll_transcript_177351

• Blastp: Annexin D8 from Arabidopsis with 59.29% of identity
• Blastx: Annexin D8 from Arabidopsis with 59.29% of identity
• Eggnog: annexin A7(ENOG410XPUN)
• Kegg: Link to kegg annotations (AT5G12380)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418411.1)
• Pfam: Annexin (PF00191.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;