Transcript | Ll_transcript_177351 |
---|---|
CDS coordinates | 882-1661 (+) |
Peptide sequence | MATVIAAKDSSPIDDAETIKRACQGLGTDEKALISILAHRNEAQRKLVRLAFQEIYHQDLIQQLQSELSGSFQRAISHWTMDPSERDAVIAHEALKKATPDYKVLIEIACTRTSQEIVAIKGSYQFLYKHSLDEDVASKTNFDIRKLLVAIISAYRYDGDEFDESVAHSEANILHHAIENKVFNHDEIIRILSTRSKKQLCVTFNAFRNIYGTTITKGLLSNPIDDDDEYLGALRTTIRCIKYPQRYFAKVTKAMNLCY* |
ORF Type | complete |
Blastp | Annexin D8 from Arabidopsis with 59.29% of identity |
---|---|
Blastx | Annexin D8 from Arabidopsis with 59.29% of identity |
Eggnog | annexin A7(ENOG410XPUN) |
Kegg | Link to kegg annotations (AT5G12380) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019418411.1) |
Pfam | Annexin (PF00191.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer