Protein coding transcript 2525

• Transcript: Ll_transcript_328989
• CDS coordinates: 92-412 (+)
• Peptide sequence: MSTPHFLAIAYPILGHLTPLLQFSQLLAKHGCKITFLTSDENYNRLKSSSVVEGNYIDSKIKLVSLPDGVGPEDDRNDQPKVILSTKTTMSAKLPKLIEDLNVMDSC
• ORF Type: 3prime_partial

Annotations of Ll_transcript_328989

• Blastp: UDP-glycosyltransferase 83A1 from Arabidopsis with 40.95% of identity
• Blastx: UDP-glycosyltransferase 83A1 from Arabidopsis with 41.12% of identity
• Eggnog: Transferase(COG1819)
• Kegg: Link to kegg annotations (AT3G02100)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420161.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;