Protein coding transcript 252539

• Transcript: Ll_transcript_177811
• CDS coordinates: 72-395 (+)
• Peptide sequence: MWNSAENAFARTSSFREQHDDDEEALRWAALQRLPTYKRARRGIFKNLTGDTNEIDVTDLEVQDQKLLIERLVHSVDDDDPNTFFHRMRSRFDAVDLEFPKIEVRFQN
• ORF Type: 3prime_partial

Annotations of Ll_transcript_177811

• Blastp: ABC transporter G family member 32 from Arabidopsis with 63.89% of identity
• Blastx: ABC transporter G family member 32 from Arabidopsis with 63.89% of identity
• Eggnog: (ABC) transporter(COG0842)
• Kegg: Link to kegg annotations (AT2G26910)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439503.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;