Transcript | Ll_transcript_177811 |
---|---|
CDS coordinates | 72-395 (+) |
Peptide sequence | MWNSAENAFARTSSFREQHDDDEEALRWAALQRLPTYKRARRGIFKNLTGDTNEIDVTDLEVQDQKLLIERLVHSVDDDDPNTFFHRMRSRFDAVDLEFPKIEVRFQN |
ORF Type | 3prime_partial |
Blastp | ABC transporter G family member 32 from Arabidopsis with 63.89% of identity |
---|---|
Blastx | ABC transporter G family member 32 from Arabidopsis with 63.89% of identity |
Eggnog | (ABC) transporter(COG0842) |
Kegg | Link to kegg annotations (AT2G26910) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019439503.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer