Protein coding transcript 252560

• Transcript: Ll_transcript_179092
• CDS coordinates: 31-582 (+)
• Peptide sequence: MYLHFYDIFLQIRETLMGIAKHYETGDSLPEEVYLKLVAARNFRAGSQSLRQIKFASVDLELHTKYVPGGQESIYDVDRRVSERTQVTPPFPEDRFLCSFSHIFAGGYAAGYYSYKWAEVLSADAFSAFEDAGLDNKKAVEETGHKFRETVLALGGGKAPLEVFVQFRGREPTPDALLRHNGLL
• ORF Type: 3prime_partial

Annotations of Ll_transcript_179092

• Blastp: Organellar oligopeptidase A, chloroplastic/mitochondrial from Arabidopsis with 80.66% of identity
• Blastx: Organellar oligopeptidase A, chloroplastic/mitochondrial from Arabidopsis with 80.66% of identity
• Eggnog: oligopeptidase a(COG0339)
• Kegg: Link to kegg annotations (AT5G65620)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445352.1)
• Pfam: Peptidase family M3 (PF01432.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;