Protein coding transcript 252597

• Transcript: Ll_transcript_177477
• CDS coordinates: 27-545 (+)
• Peptide sequence: MQGTQLKMSSAYHPETDGQTEVINRCLESYLRCFASDQPKTWSYWIPWAEFWYNTTFHVSIGTTPFEVVYGRPPPPSMRFLSNETKVAAVALELSERDEALNQLKLHLSRAQQQMVKYADKGRRNVHFEVGEWVFLKLRPHRQQSVMKRINQKLAARFYGPFQIIAKRGEVAY
• ORF Type: 3prime_partial

Annotations of Ll_transcript_177477

• Blastp: Transposon Ty3-G Gag-Pol polyprotein from Saccharomyces with 31.79% of identity
• Blastx: Transposon Ty3-G Gag-Pol polyprotein from Saccharomyces with 31.84% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (YGR109W-B)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_017438495.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;