Protein coding transcript 252619

• Transcript: Ll_transcript_177587
• CDS coordinates: 105-860 (+)
• Peptide sequence: MALPQSMTLFLSSFISPTAVKDKIPSNHFFNFTISSNFSNFPLLDSEYKAVRLPTRVQALKSSDGAGRYDSDSDSDSDSDDETPRVKENDPYSMNLEERQEWRKKIRQVMDKKPDVQEEVDPLEKNKKMQKLLADYPLVVEEEDPDWPEDADGWGFSFGQFFDKITIKNNKKANDDDDDGDNENEIVWQDDNYIRPIKDIKSSEWEETVFKDISPLIILAHNRYKRLVLILLLIHVCLYTFFILCFSILAP*
• ORF Type: complete

Annotations of Ll_transcript_177587

• Blastp: Thioredoxin-like fold domain-containing protein MRL7L, chloroplastic from Arabidopsis with 68.89% of identity
• Blastx: Thioredoxin-like fold domain-containing protein MRL7L, chloroplastic from Arabidopsis with 70.37% of identity
• Eggnog: NA(ENOG410YAAY)
• Kegg: Link to kegg annotations (AT2G31840)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452576.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;