Transcript | Ll_transcript_177579 |
---|---|
CDS coordinates | 105-1112 (+) |
Peptide sequence | MALPQSMTLFLSSFISPTAVKDKIPSNHFFNFTISSNFSNFPLLDSEYKAVRLPTRVQALKSSDGAGRYDSDSDSDSDSDDETPRVKENDPYSMNLEERQEWRKKIRQVMDKKPDVQEEVDPLEKNKKMQKLLADYPLVVEEEDPDWPEDADGWGFSFGQFFDKITIKNNKKANDDDDDGDNENEIVWQDDNYIRPIKDIKSSEWEETVFKDISPLIILAHNRYKRPKENERIRNELEKAVHIIWNCGLPSPRCVALDAVVETELVAALRVSVFPEVIFTKAGKILFRDKATRSADEFSKIMAFFYFGAAKPPCLNNITDCQEDIPSFNIDNPVS* |
ORF Type | complete |
Blastp | Thioredoxin-like fold domain-containing protein MRL7L, chloroplastic from Arabidopsis with 71.55% of identity |
---|---|
Blastx | Thioredoxin-like fold domain-containing protein MRL7L, chloroplastic from Arabidopsis with 71.55% of identity |
Eggnog | NA(ENOG410YAAY) |
Kegg | Link to kegg annotations (AT2G31840) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019428332.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer