Protein coding transcript 252628

• Transcript: Ll_transcript_177580
• CDS coordinates: 1792-2946 (+)
• Peptide sequence: MALQISRFLFIPLTLTFLLPFPSLPSAAAAAASLFSHHHHDHHRNFPFSSSLLQSPAPPVAKKVKHVMEQFGDVRIDNYYWLRDDSRTNPQVLSYLHQENNYTSSIMSGTKNFEDKLFEEIRGRIKEDDVSVPLRKGNYYYYVKNLEGKEYVQYCRRLIPHNQKVPSVYDIMPTGPEAPHEHVILDENINAQNYQYYSIGAFKVSPNNKLVAYAEDTKGNEVYSVHVIDAETKTLIGEPLVGVTSYLEWAGDDSLIYITTDETLRPDKVWLHVLGTEQSKDTCLYVEKDDMFSVDLYASESKQYLFVASESKNTRFNFYLDVLKPGEGLKILTSRVDGIDTTISHRGDHFFIKRRSDQFFNSEVVACPVDNTSSTTVLLPHRER*
• ORF Type: complete

Annotations of Ll_transcript_177580

• Blastp: Dipeptidyl aminopeptidase BI from Pseudoxanthomonas with 35.45% of identity
• Blastx: Protease 2 from Moraxella with 53.71% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452573.1)
• Pfam: Prolyl oligopeptidase, N-terminal beta-propeller domain (PF02897.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;