Protein coding transcript 252641

• Transcript: Ll_transcript_178984
• CDS coordinates: 149-574 (+)
• Peptide sequence: MDFVKRMKLYAESLARFQGGSPYIYPLYGLGELPQGFARLSAVYGGTYMLNKPECKVEFDESGKAIGVTSEGETAKCKKVVCDPSYLPDKVKKVGKVNRAICIMSHPIPSTHDSPSVQVILPQKQLGRKSDMYLFCCSYSHN
• ORF Type: 3prime_partial

Annotations of Ll_transcript_178984

• Blastp: Guanosine nucleotide diphosphate dissociation inhibitor At5g09550 from Arabidopsis with 89.44% of identity
• Blastx: Guanosine nucleotide diphosphate dissociation inhibitor At5g09550 from Arabidopsis with 87.36% of identity
• Eggnog: GDP dissociation inhibitor(COG5044)
• Kegg: Link to kegg annotations (AT5G09550)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421405.1)
• Pfam: GDP dissociation inhibitor (PF00996.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;