Transcript | Ll_transcript_179008 |
---|---|
CDS coordinates | 161-967 (+) |
Peptide sequence | MMANGTLVRVLIHTNVTKYLNFKAVDGSFVYNKGKIHKVPANDVEALKSPLMGLFEKRRARKFFIYVQDYDENDPKSHEGMDLNQVTAKELISKYGLDDNTIDFIGHALALHLDDEYLTQPATDFVKRMKLYAESLARFQGGSPYIYPLYGLGELPQGFARLSAVYGGTYMLNKPECKVEFDENGKAIGVTSEGETAKCKKVVCDPSYLPTKVKKVGKVNRAICIMSHPIPSTHDSPSVQVILPQKQLGRKSDMYLFCCSYSHNVAPKG |
ORF Type | 3prime_partial |
Blastp | Guanosine nucleotide diphosphate dissociation inhibitor At5g09550 from Arabidopsis with 86.99% of identity |
---|---|
Blastx | Guanosine nucleotide diphosphate dissociation inhibitor At5g09550 from Arabidopsis with 87.08% of identity |
Eggnog | GDP dissociation inhibitor(COG5044) |
Kegg | Link to kegg annotations (AT5G09550) |
CantataDB | Link to cantataDB annotations (CNT0002686) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019445391.1) |
Pfam | GDP dissociation inhibitor (PF00996.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer