Protein coding transcript 252648

• Transcript: Ll_transcript_178986
• CDS coordinates: 2-544 (+)
• Peptide sequence: ENDPKSHEGMNLNQVTAKELISKYGLDDNTIDFIGHALALHLDDEYLTQPAMDFVKRMKLYAESLARFQGGSPYIYPLYGLGELPQGFARLSAVYGGTYMLNKPECKVEFDESGKAIGVTSEGETAKCKKVVCDPSYLPDKVKKVGKVNRAICIMSHPIPNTHDSPSVQVILPQKQLGRKS
• ORF Type: internal

Annotations of Ll_transcript_178986

• Blastp: Guanosine nucleotide diphosphate dissociation inhibitor At5g09550 from Arabidopsis with 85.64% of identity
• Blastx: Guanosine nucleotide diphosphate dissociation inhibitor At5g09550 from Arabidopsis with 85.64% of identity
• Eggnog: GDP dissociation inhibitor(COG5044)
• Kegg: Link to kegg annotations (AT5G09550)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445391.1)
• Pfam: GDP dissociation inhibitor (PF00996.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;